PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.010G081800.2
Common NameB456_010G081800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 204aa    MW: 22291.5 Da    PI: 10.5631
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.010G081800.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.76.5e-14113157347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+ +++ + ++lG+g+W+ I+r + ++Rt+ q+ s+ qky
  Gorai.010G081800.2 113 PWTEEEHRIFLIGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKY 157
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.104.9E-4320IPR001878Zinc finger, CCHC-type
PROSITE profilePS501588.532318IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.74105162IPR017930Myb domain
SuperFamilySSF466898.97E-18108162IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-18109161IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.1E-11110156IPR009057Homeodomain-like
SMARTSM007174.4E-10110160IPR001005SANT/Myb domain
CDDcd001671.21E-9113158No hitNo description
PfamPF002493.1E-11113157IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MGRKCSHCGN IGHNSRTCTT FRSSAAGMGS GLRLFGFQLQ LDVSSPSVVS NLMMKKSFSM  60
DCLSSSPSPS PSPSPSSLSS SRVSIDENSD KTSMGYLSDG LMGRSPDRKK GVPWTEEEHR  120
IFLIGLEKLG KGDWRGISRN FVTTRTPTQV ASHAQKYFLR QATLNKKNRR SSLFDMVPSF  180
FNSMVLNETI CLRLISCSKT MAG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.8610.0seedling
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO487411490.0
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00565DAPTransfer from AT5G56840Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ3932391e-135GQ393239.1 Gossypium hirsutum cultivar Deltapine 33 B clone MONCS0204 SSR marker CGR5100 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012452356.11e-112PREDICTED: transcription factor MYB1R1-like
TrEMBLA0A0D2V7A21e-148A0A0D2V7A2_G
STRINGVIT_04s0008g00900.t012e-75(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.11e-60MYB_related family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]